Anti MPO pAb (ATL-HPA021147 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA021147-25

Protein Description: myeloperoxidase
Gene Name: MPO
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000009350: 89%, ENSRNOG00000008310: 89%
Entrez Gene ID: 4353
Uniprot ID: P05164
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SRDHGLPGYNAWRRFCGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRVGPLLACIIGTQFRKLRDGDRFWWENEGVFSMQQRQALAQISLPRIICDNTGITTVSKNNIFMSNSYPRDFVNC
• Gene Sequence: SRDHGLPGYNAWRRFCGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRVGPLLACIIGTQFRKLRDGDRFWWENEGVFSMQQRQALAQISLPRIICDNTGITTVSKNNIFMSNSYPRDFVNC
• Gene ID - Mouse: ENSMUSG00000009350
• Gene ID - Rat: ENSRNOG00000008310
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MPO pAb (ATL-HPA021147 w/enhanced validation) – 3 Found

Yang, Bao; Yang, Chenlong; Fang, Jingyi; Yang, Jun; Xu, Yulun. Clinicoradiological characteristics, management and prognosis of primary myeloid sarcoma of the central nervous system: A report of four cases. Oncology Letters. 2017;14(3):3825-3831. 

Wang, Xin; Li, Wen-Sheng; Zheng, Yan; Ying, Zhao-Xia; Wang, Yong-Xian; Wang, Ying-Mei; Zheng, Jun-Feng; Xiao, Sheng-Xiang. The progression of CD56(+) myeloid sarcoma: A case report and literature review. Oncology Letters. 2016;11(5):3091-3096. 

Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476.