Anti MOS pAb (ATL-HPA040424 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA040424-25

Protein Description: v-mos Moloney murine sarcoma viral oncogene homolog
Gene Name: MOS
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078365: 72%, ENSRNOG00000008567: 73%
Entrez Gene ID: 4342
Uniprot ID: P00540
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CKISDFGCSEKLEDLLCFQTPSYPLGGTYTHRAPELLKGEGVTPKADIYSFAITLWQMTTKQAPYSGERQHILYAVVAYDLRPSLSAAVF
• Gene Sequence: CKISDFGCSEKLEDLLCFQTPSYPLGGTYTHRAPELLKGEGVTPKADIYSFAITLWQMTTKQAPYSGERQHILYAVVAYDLRPSLSAAVF
• Gene ID - Mouse: ENSMUSG00000078365
• Gene ID - Rat: ENSRNOG00000008567
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.