Anti MORN3 pAb (ATL-HPA038709 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA038709-25

Protein Description: MORN repeat containing 3
Gene Name: MORN3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029477: 87%, ENSRNOG00000045574: 86%
Entrez Gene ID: 283385
Uniprot ID: Q6PF18
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SLPDQQTGKCRRVYSGWWKGDKKSGYGIQFFGPKEYYEGDWCGSQRSGWGRMYYSNGDIYEGQWENDKPNGEGMLRL
• Gene Sequence: SLPDQQTGKCRRVYSGWWKGDKKSGYGIQFFGPKEYYEGDWCGSQRSGWGRMYYSNGDIYEGQWENDKPNGEGMLRL
• Gene ID - Mouse: ENSMUSG00000029477
• Gene ID - Rat: ENSRNOG00000045574
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.