Anti MON1B pAb (ATL-HPA046285)

Atlas Antibodies

Catalog No.:
ATL-HPA046285-100
Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: MON1 secretory trafficking family member B
Gene Name: MON1B
Alternative Gene Name: HSRG1, KIAA0872, SAND2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078908: 60%, ENSRNOG00000011552: 38%
Entrez Gene ID: 22879
Uniprot ID: Q7L1V2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EVGGDTAAPAPGGAEDLEDTQFPSEEAREGGGVHAVPPDPEDEGLEETGSKDKDQPPSPSPPPQSEALSSTSRL
Gene Sequence EVGGDTAAPAPGGAEDLEDTQFPSEEAREGGGVHAVPPDPEDEGLEETGSKDKDQPPSPSPPPQSEALSSTSRL
Gene ID - Mouse ENSMUSG00000078908
Gene ID - Rat ENSRNOG00000011552
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MON1B pAb (ATL-HPA046285)
Datasheet Anti MON1B pAb (ATL-HPA046285) Datasheet (External Link)
Vendor Page Anti MON1B pAb (ATL-HPA046285) at Atlas Antibodies

Documents & Links for Anti MON1B pAb (ATL-HPA046285)
Datasheet Anti MON1B pAb (ATL-HPA046285) Datasheet (External Link)
Vendor Page Anti MON1B pAb (ATL-HPA046285)
!