Anti MMRN1 pAb (ATL-HPA035769 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA035769-25

Protein Description: multimerin 1
Gene Name: MMRN1
Alternative Gene Name: ECM, EMILIN4, GPIa*, MMRN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054641: 66%, ENSRNOG00000024986: 63%
Entrez Gene ID: 22915
Uniprot ID: Q13201
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RHNLLRNEVQGRDDALERRINEYALEMEDGLNKTMTIINNAIDFIQDNYALKETLSTIKDNSEIHHKCTSDMETILTFIPQFHRLND
• Gene Sequence: RHNLLRNEVQGRDDALERRINEYALEMEDGLNKTMTIINNAIDFIQDNYALKETLSTIKDNSEIHHKCTSDMETILTFIPQFHRLND
• Gene ID - Mouse: ENSMUSG00000054641
• Gene ID - Rat: ENSRNOG00000024986
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.