Anti MMAA pAb (ATL-HPA037361)

Atlas Antibodies

Catalog No.: ATL-HPA037361-25

Protein Description: methylmalonic aciduria (cobalamin deficiency) cblA type
Gene Name: MMAA
Alternative Gene Name: cblA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037022: 76%, ENSRNOG00000011618: 74%
Entrez Gene ID: 166785
Uniprot ID: Q8IVH4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EMWDKMKDFQDLMLASGELTAKRRKQQKVWMWNLIQESVLEHFRTHPTVREQIPLLEQKVLIGALSPGLAADFL
• Gene Sequence: EMWDKMKDFQDLMLASGELTAKRRKQQKVWMWNLIQESVLEHFRTHPTVREQIPLLEQKVLIGALSPGLAADFL
• Gene ID - Mouse: ENSMUSG00000037022
• Gene ID - Rat: ENSRNOG00000011618
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.