Anti-MLLT10 pAb (ATL-HPA072790)

Atlas Antibodies

Catalog No.:
ATL-HPA072790-100
Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Lane 1: Marker [kDa] 250,130,95,72,55,36,28,17,10<br/>Lane 2: RT-4<br/>Lane 3: U-251MG<br/>Lane 4: Human Plasma<br/>Lane 5: Liver<br/>Lane 6: Tonsil
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Polyclonal Antibody against Human MLLT10, Gene description: MLLT10 histone lysine methyltransferase DOT1L cofactor, Alternative Gene Names: AF10, Validated applications: IHC, WB, Uniprot ID: P55197, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC, WB
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQQLTPVHRHPHFTQLPPTHFSPSM
Gene Sequence IVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQQLTPVHRHPHFTQLPPTHFSPSM
Gene ID - Mouse ENSMUSG00000026743
Gene ID - Rat ENSRNOG00000022249
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti-MLLT10 pAb (ATL-HPA072790)
Vendor Page Anti-MLLT10 pAb (ATL-HPA072790) at Atlas Antibodies

Documents & Links for Anti-MLLT10 pAb (ATL-HPA072790)
Vendor Page Anti-MLLT10 pAb (ATL-HPA072790)
!