Anti MKRN2 pAb (ATL-HPA037560 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA037560-25

Protein Description: makorin ring finger protein 2
Gene Name: MKRN2
Alternative Gene Name: HSPC070, RNF62
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000439: 92%, ENSRNOG00000009176: 92%
Entrez Gene ID: 23609
Uniprot ID: Q9H000
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ACKYFEQGKGTCPFGSKCLYRHAYPDGRLAEPEKPRKQLSSQGTVRFFNSVRLWDFIENRESRHVPNNEDVDMTELGDLFMHLSGVESS
• Gene Sequence: ACKYFEQGKGTCPFGSKCLYRHAYPDGRLAEPEKPRKQLSSQGTVRFFNSVRLWDFIENRESRHVPNNEDVDMTELGDLFMHLSGVESS
• Gene ID - Mouse: ENSMUSG00000000439
• Gene ID - Rat: ENSRNOG00000009176
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.