Anti MIOX pAb (ATL-HPA039562 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA039562-25

Protein Description: myo-inositol oxygenase
Gene Name: MIOX
Alternative Gene Name: ALDRL6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022613: 95%, ENSRNOG00000008694: 95%
Entrez Gene ID: 55586
Uniprot ID: Q9UGB7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QWAVVGDTFPVGCRPQASVVFCDSTFQDNPDLQDPRYSTELGMYQPHCGLDRVLMSWGHDEYMYQVMKFNKFSL
• Gene Sequence: QWAVVGDTFPVGCRPQASVVFCDSTFQDNPDLQDPRYSTELGMYQPHCGLDRVLMSWGHDEYMYQVMKFNKFSL
• Gene ID - Mouse: ENSMUSG00000022613
• Gene ID - Rat: ENSRNOG00000008694
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MIOX pAb (ATL-HPA039562 w/enhanced validation) – 1 Found

Marable, Sierra S; Chung, Eunah; Park, Joo-Seop. Hnf4a Is Required for the Development of Cdh6-Expressing Progenitors into Proximal Tubules in the Mouse Kidney. Journal Of The American Society Of Nephrology : Jasn. 2020;31(11):2543-2558.