Anti METTL21A pAb (ATL-HPA034712)

Atlas Antibodies

Catalog No.: ATL-HPA034712-25

Protein Description: methyltransferase like 21A
Gene Name: METTL21A
Alternative Gene Name: FAM119A, HCA557b, HSPA-KMT, LOC151194
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025956: 86%, ENSRNOG00000014212: 86%
Entrez Gene ID: 151194
Uniprot ID: Q8WXB1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EHLCSNHSVILLACRIRYERDNNFLAMLERQFIVRKVHYDPEKDVHIYEAQKRNQKEDL
• Gene Sequence: EHLCSNHSVILLACRIRYERDNNFLAMLERQFIVRKVHYDPEKDVHIYEAQKRNQKEDL
• Gene ID - Mouse: ENSMUSG00000025956
• Gene ID - Rat: ENSRNOG00000014212
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti METTL21A pAb (ATL-HPA034712) – 1 Found

Jakobsson, Magnus E; Moen, Anders; Falnes, Pål Ø. Correspondence: On the enzymology and significance of HSPA1 lysine methylation. Nature Communications. 2016;7( 27321414):11464.