Anti METTL12 pAb (ATL-HPA038533 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA038533-100

Protein Description: methyltransferase like 12
Gene Name: METTL12
Alternative Gene Name: U99HG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072849: 29%, ENSRNOG00000047657: 30%
Entrez Gene ID: 751071
Uniprot ID: A8MUP2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TGLYTKSPHPVDVLGVDFSPVAVAHMNSLLEGGPGQTPLCPGHPASSLHFMHADAQNLGAVASSGSFQLLLD
• Gene Sequence: TGLYTKSPHPVDVLGVDFSPVAVAHMNSLLEGGPGQTPLCPGHPASSLHFMHADAQNLGAVASSGSFQLLLD
• Gene ID - Mouse: ENSMUSG00000072849
• Gene ID - Rat: ENSRNOG00000047657
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.