Anti METAP1 pAb (ATL-HPA037997)

Atlas Antibodies

Catalog No.: ATL-HPA037997-25

Protein Description: methionyl aminopeptidase 1
Gene Name: METAP1
Alternative Gene Name: KIAA0094, MAP1A, MetAP1A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005813: 100%, ENSRNOG00000012947: 100%
Entrez Gene ID: 23173
Uniprot ID: P53582
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEH
• Gene Sequence: SVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEH
• Gene ID - Mouse: ENSMUSG00000005813
• Gene ID - Rat: ENSRNOG00000012947
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.