Anti MED20 pAb (ATL-HPA040717)

Atlas Antibodies

Catalog No.:
ATL-HPA040717-25
Immunohistochemical staining of human endometrium shows moderate nuclear positivity.
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & centrosome.
ChIP-Exo-Seq composite graph for Anti-MED20 (HPA040717, Lot C115425) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh's Lab at Cornell University.
Immunohistochemical staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.
Immunohistochemical staining of human kidney shows moderate nuclear positivity in cells in tubules.
Immunohistochemical staining of human pancreas shows moderate nuclear positivity in exocrine glandular cells.
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: mediator complex subunit 20
Gene Name: MED20
Alternative Gene Name: DKFZp586D2223, PRO0213, TRFP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000092558: 99%, ENSRNOG00000013852: 99%
Entrez Gene ID: 9477
Uniprot ID: Q9H944
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC, ChIP
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EKQGTFCVDCETYHTAASTLGSQGQTGKLMYVMHNSEYPLSCFALFENGPCLIADTNFDVLMVKLKGFFQSAKASKIETRGTRYQYCDFLVKVGTVTMGPSARGISVEVEYGPCVV
Gene Sequence EKQGTFCVDCETYHTAASTLGSQGQTGKLMYVMHNSEYPLSCFALFENGPCLIADTNFDVLMVKLKGFFQSAKASKIETRGTRYQYCDFLVKVGTVTMGPSARGISVEVEYGPCVV
Gene ID - Mouse ENSMUSG00000092558
Gene ID - Rat ENSRNOG00000013852
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MED20 pAb (ATL-HPA040717)
Datasheet Anti MED20 pAb (ATL-HPA040717) Datasheet (External Link)
Vendor Page Anti MED20 pAb (ATL-HPA040717) at Atlas Antibodies

Documents & Links for Anti MED20 pAb (ATL-HPA040717)
Datasheet Anti MED20 pAb (ATL-HPA040717) Datasheet (External Link)
Vendor Page Anti MED20 pAb (ATL-HPA040717)
!