Anti MCRS1 pAb (ATL-HPA039057)

Atlas Antibodies

Catalog No.: ATL-HPA039057-25

Protein Description: microspherule protein 1
Gene Name: MCRS1
Alternative Gene Name: ICP22BP, INO80Q, MCRS2, MSP58, P78
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037570: 99%, ENSRNOG00000054838: 99%
Entrez Gene ID: 10445
Uniprot ID: Q96EZ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HPDAFYLARTAKALQAHWQLMKQYYLLEDQTVQPLPKGDQVLNFSDAEDLIDDSKLKDMRDEVLEHELMVADRRQKREIRQLEQELHKWQVLVD
• Gene Sequence: HPDAFYLARTAKALQAHWQLMKQYYLLEDQTVQPLPKGDQVLNFSDAEDLIDDSKLKDMRDEVLEHELMVADRRQKREIRQLEQELHKWQVLVD
• Gene ID - Mouse: ENSMUSG00000037570
• Gene ID - Rat: ENSRNOG00000054838
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MCRS1 pAb (ATL-HPA039057) – 2 Found

So, Chun; Seres, K Bianka; Steyer, Anna M; Mönnich, Eike; Clift, Dean; Pejkovska, Anastasija; Möbius, Wiebke; Schuh, Melina. A liquid-like spindle domain promotes acentrosomal spindle assembly in mammalian oocytes. Science (New York, N.y.). 2019;364(6447) 

Cui, Wei; Cheong, Agnes; Wang, Yongsheng; Tsuchida, Yuran; Liu, Yong; Tremblay, Kimberly D; Mager, Jesse. MCRS1 is essential for epiblast development during early mouse embryogenesis. Reproduction (Cambridge, England). 2020;159(1):1-13.