Anti MBLAC2 pAb (ATL-HPA037757 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA037757-25

Protein Description: metallo-beta-lactamase domain containing 2
Gene Name: MBLAC2
Alternative Gene Name: DKFZp686P15118, MGC46734
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051098: 99%, ENSRNOG00000016252: 99%
Entrez Gene ID: 153364
Uniprot ID: Q68D91
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RGDNFETVTWLSDSEVVRAPSPGWRARQFRVQAVQPTLILQDGDVINLGDRQLTVMHMPGHSRGSICLHDKDRKILFSGDVVYDGSLI
• Gene Sequence: RGDNFETVTWLSDSEVVRAPSPGWRARQFRVQAVQPTLILQDGDVINLGDRQLTVMHMPGHSRGSICLHDKDRKILFSGDVVYDGSLI
• Gene ID - Mouse: ENSMUSG00000051098
• Gene ID - Rat: ENSRNOG00000016252
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MBLAC2 pAb (ATL-HPA037757 w/enhanced validation) – 1 Found

Malgapo, Martin Ian P; Safadi, Jenelle M; Linder, Maurine E. Metallo-β-lactamase domain-containing protein 2 is S-palmitoylated and exhibits acyl-CoA hydrolase activity. The Journal Of Biological Chemistry. 2021;296( 33219126):100106.