Anti MAT2B pAb (ATL-HPA037721 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA037721-100

Protein Description: methionine adenosyltransferase II, beta
Gene Name: MAT2B
Alternative Gene Name: MATIIbeta, SDR23E1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042032: 95%, ENSRNOG00000003177: 95%
Entrez Gene ID: 27430
Uniprot ID: Q9NZL9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AVGAFLIYISSDYVFDGTNPPYREEDIPAPLNLYGKTKLDGEKAVLENNLGAAVLRIPILYGEVEKLEESAVTVM
• Gene Sequence: AVGAFLIYISSDYVFDGTNPPYREEDIPAPLNLYGKTKLDGEKAVLENNLGAAVLRIPILYGEVEKLEESAVTVM
• Gene ID - Mouse: ENSMUSG00000042032
• Gene ID - Rat: ENSRNOG00000003177
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.