Anti MARK2 pAb (ATL-HPA038790)

Atlas Antibodies

Catalog No.: ATL-HPA038790-25

Protein Description: MAP/microtubule affinity-regulating kinase 2
Gene Name: MARK2
Alternative Gene Name: EMK1, PAR-1, PAR-1B, Par1b
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024969: 97%, ENSRNOG00000021184: 97%
Entrez Gene ID: 2011
Uniprot ID: Q7KZI7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SIFSKFTSKFVRRNLNEPESKDRVETLRPHVVGSGGNDKEKEEFREAKPRSLRFTWSMKTTSSMEPNE
• Gene Sequence: SIFSKFTSKFVRRNLNEPESKDRVETLRPHVVGSGGNDKEKEEFREAKPRSLRFTWSMKTTSSMEPNE
• Gene ID - Mouse: ENSMUSG00000024969
• Gene ID - Rat: ENSRNOG00000021184
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MARK2 pAb (ATL-HPA038790) – 2 Found

Gervais, Elise M; Sequeira, Sharon J; Wang, Weihao; Abraham, Stanley; Kim, Janice H; Leonard, Daniel; DeSantis, Kara A; Larsen, Melinda. Par-1b is required for morphogenesis and differentiation of myoepithelial cells during salivary gland development. Organogenesis. 2016;12(4):194-216. 

Kovalski, Joanna R; Bhaduri, Aparna; Zehnder, Ashley M; Neela, Poornima H; Che, Yonglu; Wozniak, Glenn G; Khavari, Paul A. The Functional Proximal Proteome of Oncogenic Ras Includes mTORC2. Molecular Cell. 2019;73(4):830-844.e12.