Anti MAPKBP1 pAb (ATL-HPA030833 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA030833-25

Protein Description: mitogen-activated protein kinase binding protein 1
Gene Name: MAPKBP1
Alternative Gene Name: KIAA0596
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033902: 78%, ENSRNOG00000007018: 76%
Entrez Gene ID: 23005
Uniprot ID: O60336
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PSSPQRASGPNRHQAPSMLSPGPALSSDSDKEGEDEGTEEELPALPVLAKSTKKALASVPSPALPRSLSHWEMSRAQ
• Gene Sequence: PSSPQRASGPNRHQAPSMLSPGPALSSDSDKEGEDEGTEEELPALPVLAKSTKKALASVPSPALPRSLSHWEMSRAQ
• Gene ID - Mouse: ENSMUSG00000033902
• Gene ID - Rat: ENSRNOG00000007018
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.