Anti MAPKBP1 pAb (ATL-HPA030832)

Atlas Antibodies

Catalog No.: ATL-HPA030832-25

Protein Description: mitogen-activated protein kinase binding protein 1
Gene Name: MAPKBP1
Alternative Gene Name: KIAA0596
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033902: 90%, ENSRNOG00000007018: 90%
Entrez Gene ID: 23005
Uniprot ID: O60336
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EKHSPDSACSVDYSSSCLSSPEHPTEDSESTEPLSVDGISSDLEEPAEGDEEEEEEEGGMGPYGLQEGSPQTPDQEQFLKQHFETLA
• Gene Sequence: EKHSPDSACSVDYSSSCLSSPEHPTEDSESTEPLSVDGISSDLEEPAEGDEEEEEEEGGMGPYGLQEGSPQTPDQEQFLKQHFETLA
• Gene ID - Mouse: ENSMUSG00000033902
• Gene ID - Rat: ENSRNOG00000007018
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MAPKBP1 pAb (ATL-HPA030832) – 2 Found

Macia, Maxence S; Halbritter, Jan; Delous, Marion; Bredrup, Cecilie; Gutter, Arthur; Filhol, Emilie; Mellgren, Anne E C; Leh, Sabine; Bizet, Albane; Braun, Daniela A; Gee, Heon Y; Silbermann, Flora; Henry, Charline; Krug, Pauline; Bole-Feysot, Christine; Nitschké, Patrick; Joly, Dominique; Nicoud, Philippe; Paget, André; Haugland, Heidi; Brackmann, Damien; Ahmet, Nayir; Sandford, Richard; Cengiz, Nurcan; Knappskog, Per M; Boman, Helge; Linghu, Bolan; Yang, Fan; Oakeley, Edward J; Saint Mézard, Pierre; Sailer, Andreas W; Johansson, Stefan; Rødahl, Eyvind; Saunier, Sophie; Hildebrandt, Friedhelm; Benmerah, Alexandre. Mutations in MAPKBP1 Cause Juvenile or Late-Onset Cilia-Independent Nephronophthisis. American Journal Of Human Genetics. 2017;100(2):323-333. 

Lecat, Aurore; Di Valentin, Emmanuel; Somja, Joan; Jourdan, Samuel; Fillet, Marianne; Kufer, Thomas A; Habraken, Yvette; Sadzot, Catherine; Louis, Edouard; Delvenne, Philippe; Piette, Jacques; Legrand-Poels, Sylvie. The c-Jun N-terminal kinase (JNK)-binding protein (JNKBP1) acts as a negative regulator of NOD2 protein signaling by inhibiting its oligomerization process. The Journal Of Biological Chemistry. 2012;287(35):29213-26.