Anti MAP3K5 pAb (ATL-HPA064423)

Atlas Antibodies

Catalog No.: ATL-HPA064423-25

Protein Description: mitogen-activated protein kinase kinase kinase 5
Gene Name: MAP3K5
Alternative Gene Name: ASK1, MAPKKK5, MEKK5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071369: 86%, ENSRNOG00000031700: 84%
Entrez Gene ID: 4217
Uniprot ID: Q99683
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KSQPIEIPELPVFHLNSSGTNTEDSELTDWLRVNGADEDTISRFLAEDYTLLDVLYYVTRDDLKCLRLRGGMLCTLWKAIIDFRNKQT
• Gene Sequence: KSQPIEIPELPVFHLNSSGTNTEDSELTDWLRVNGADEDTISRFLAEDYTLLDVLYYVTRDDLKCLRLRGGMLCTLWKAIIDFRNKQT
• Gene ID - Mouse: ENSMUSG00000071369
• Gene ID - Rat: ENSRNOG00000031700
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.