Anti MAP3K3 pAb (ATL-HPA035411)

Atlas Antibodies

Catalog No.: ATL-HPA035411-25

Protein Description: mitogen-activated protein kinase kinase kinase 3
Gene Name: MAP3K3
Alternative Gene Name: MAPKKK3, MEKK3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020700: 54%, ENSRNOG00000061424: 54%
Entrez Gene ID: 4215
Uniprot ID: Q99759
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EQEALNSIMNDLVALQMNRRHRMPGYETMKNKDTGHSNRQKKHNSSSSALLNSPTVTTSSCAGASEKKKFLSDVRIKFEHNGE
• Gene Sequence: EQEALNSIMNDLVALQMNRRHRMPGYETMKNKDTGHSNRQKKHNSSSSALLNSPTVTTSSCAGASEKKKFLSDVRIKFEHNGE
• Gene ID - Mouse: ENSMUSG00000020700
• Gene ID - Rat: ENSRNOG00000061424
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.