Anti MAP2K6 pAb (ATL-HPA031134 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA031134-25

Protein Description: mitogen-activated protein kinase kinase 6
Gene Name: MAP2K6
Alternative Gene Name: MAPKK6, MEK6, MKK6, PRKMK6, SAPKK3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020623: 98%, ENSRNOG00000004437: 97%
Entrez Gene ID: 5608
Uniprot ID: P52564
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGR
• Gene Sequence: SQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGR
• Gene ID - Mouse: ENSMUSG00000020623
• Gene ID - Rat: ENSRNOG00000004437
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.