Anti MAP1LC3A pAb (ATL-HPA007649 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA007649-25

Protein Description: microtubule-associated protein 1 light chain 3 alpha
Gene Name: MAP1LC3A
Alternative Gene Name: ATG8E, LC3, LC3A, MAP1ALC3, MAP1BLC3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027602: 100%, ENSRNOG00000025443: 100%
Entrez Gene ID: 84557
Uniprot ID: Q9H492
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMS
• Gene Sequence: MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMS
• Gene ID - Mouse: ENSMUSG00000027602
• Gene ID - Rat: ENSRNOG00000025443
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MAP1LC3A pAb (ATL-HPA007649 w/enhanced validation) – 1 Found

Funk, K E; Mrak, R E; Kuret, J. Granulovacuolar degeneration (GVD) bodies of Alzheimer's disease (AD) resemble late-stage autophagic organelles. Neuropathology And Applied Neurobiology. 2011;37(3):295-306.