Anti MAP1A pAb (ATL-HPA039064 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA039064-25

Protein Description: microtubule-associated protein 1A
Gene Name: MAP1A
Alternative Gene Name: MAP1L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027254: 60%, ENSRNOG00000014230: 52%
Entrez Gene ID: 4130
Uniprot ID: P78559
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSFSHSTPSGNGKYLPGAITSPDEHILTPDSSFSKSPESLPGPALEDIAIKWEDKVPGLKDRTSEQKKEPEPKDEVLQQKD
• Gene Sequence: SSFSHSTPSGNGKYLPGAITSPDEHILTPDSSFSKSPESLPGPALEDIAIKWEDKVPGLKDRTSEQKKEPEPKDEVLQQKD
• Gene ID - Mouse: ENSMUSG00000027254
• Gene ID - Rat: ENSRNOG00000014230
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MAP1A pAb (ATL-HPA039064 w/enhanced validation) – 1 Found

Jiao, Luyan; Zheng, Meige; Duan, Jinhai; Wu, Ting; Li, Zhao; Liu, Lin; Xiang, Xianhong; Tang, Xiaolu; He, Jinyang; Li, Xingjian; Zhang, Guofeng; Ding, Jinhui; Cai, Huaibin; Lin, Xian. Tau knockout exacerbates degeneration of parvalbumin-positive neurons in substantia nigra pars reticulata in Parkinson's disease-related α-synuclein A53T mice. Faseb Journal : Official Publication Of The Federation Of American Societies For Experimental Biology. 2020;34(9):12239-12254.