Anti MAK16 pAb (ATL-HPA044417)

Atlas Antibodies

Catalog No.:
ATL-HPA044417-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: MAK16 homolog (S. cerevisiae)
Gene Name: MAK16
Alternative Gene Name: MAK16L, RBM13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031578: 97%, ENSRNOG00000010783: 95%
Entrez Gene ID: 84549
Uniprot ID: Q9BXY0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QSDDVIWDTLGNKQFCSFKIRTKTQSFCRNEYSLTGLCNRSSCPLANSQYATIKEEKGQCYLYMKV
Gene Sequence QSDDVIWDTLGNKQFCSFKIRTKTQSFCRNEYSLTGLCNRSSCPLANSQYATIKEEKGQCYLYMKV
Gene ID - Mouse ENSMUSG00000031578
Gene ID - Rat ENSRNOG00000010783
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MAK16 pAb (ATL-HPA044417)
Datasheet Anti MAK16 pAb (ATL-HPA044417) Datasheet (External Link)
Vendor Page Anti MAK16 pAb (ATL-HPA044417) at Atlas Antibodies

Documents & Links for Anti MAK16 pAb (ATL-HPA044417)
Datasheet Anti MAK16 pAb (ATL-HPA044417) Datasheet (External Link)
Vendor Page Anti MAK16 pAb (ATL-HPA044417)