Anti MAGED2 pAb (ATL-HPA031573 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA031573-25

Protein Description: melanoma antigen family D, 2
Gene Name: MAGED2
Alternative Gene Name: 11B6, BCG1, HCA10, JCL-1, MAGE-D2, MAGED, MGC8386
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025268: 70%, ENSRNOG00000002449: 74%
Entrez Gene ID: 10916
Uniprot ID: Q9UNF1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LTDTQVLAAENKSLAADTKKQNADPQAVTMPATETKKVSHVADTKVNTKAQETEAAPSQAPADEPEPESAAAQSQENQDTR
• Gene Sequence: LTDTQVLAAENKSLAADTKKQNADPQAVTMPATETKKVSHVADTKVNTKAQETEAAPSQAPADEPEPESAAAQSQENQDTR
• Gene ID - Mouse: ENSMUSG00000025268
• Gene ID - Rat: ENSRNOG00000002449
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MAGED2 pAb (ATL-HPA031573 w/enhanced validation) – 2 Found

Hashimoto, Ryoji; Kanda, Mitsuro; Takami, Hideki; Shimizu, Dai; Oya, Hisaharu; Hibino, Soki; Okamura, Yukiyasu; Yamada, Suguru; Fujii, Tsutomu; Nakayama, Goro; Sugimoto, Hiroyuki; Koike, Masahiko; Nomoto, Shuji; Fujiwara, Michitaka; Kodera, Yasuhiro. Aberrant expression of melanoma-associated antigen-D2 serves as a prognostic indicator of hepatocellular carcinoma outcome following curative hepatectomy. Oncology Letters. 2015;9(3):1201-1206. 

Laghmani, Kamel; Beck, Bodo B; Yang, Sung-Sen; Seaayfan, Elie; Wenzel, Andrea; Reusch, Björn; Vitzthum, Helga; Priem, Dario; Demaretz, Sylvie; Bergmann, Klasien; Duin, Leonie K; Göbel, Heike; Mache, Christoph; Thiele, Holger; Bartram, Malte P; Dombret, Carlos; Altmüller, Janine; Nürnberg, Peter; Benzing, Thomas; Levtchenko, Elena; Seyberth, Hannsjörg W; Klaus, Günter; Yigit, Gökhan; Lin, Shih-Hua; Timmer, Albert; de Koning, Tom J; Scherjon, Sicco A; Schlingmann, Karl P; Bertrand, Mathieu J M; Rinschen, Markus M; de Backer, Olivier; Konrad, Martin; Kömhoff, Martin. Polyhydramnios, Transient Antenatal Bartter's Syndrome, and MAGED2 Mutations. The New England Journal Of Medicine. 2016;374(19):1853-63.