Anti MAGEB18 pAb (ATL-HPA046141 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA046141-100

Protein Description: melanoma antigen family B, 18
Gene Name: MAGEB18
Alternative Gene Name: MGC33889
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000067649: 38%, ENSRNOG00000038230: 41%
Entrez Gene ID: 286514
Uniprot ID: Q96M61
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: STTNAIAPVSCSSNEGASSQDEKSLGSSREAEGWKEDPLNKKVVSLVHFLLQKYETKEPIT
• Gene Sequence: STTNAIAPVSCSSNEGASSQDEKSLGSSREAEGWKEDPLNKKVVSLVHFLLQKYETKEPIT
• Gene ID - Mouse: ENSMUSG00000067649
• Gene ID - Rat: ENSRNOG00000038230
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.