Anti MACF1 pAb (ATL-HPA068103)

Atlas Antibodies

SKU: ATL-HPA068103-25

• 

Protein Description: microtubule-actin crosslinking factor 1
Gene Name: MACF1
Alternative Gene Name: ABP620, ACF7, FLJ45612, FLJ46776, KIAA0465, KIAA1251, MACF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000107235: 23%, ENSRNOG00000014314: 23%
Entrez Gene ID: 23499
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FSGAALEKEQHLGLLHVRAKDYDTRLDCGYFNTLDSSQVPNAVELIAHVDIMRDTSTVSKEECEKVPFSPRTAEFKSRQPADLDSLEKLDPG
• Gene Sequence: FSGAALEKEQHLGLLHVRAKDYDTRLDCGYFNTLDSSQVPNAVELIAHVDIMRDTSTVSKEECEKVPFSPRTAEFKSRQPADLDSLEKLDPG
• Gene ID - Mouse: ENSMUSG00000107235
• Gene ID - Rat: ENSRNOG00000014314
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.