Anti LZTS3 pAb (ATL-HPA031009)

Atlas Antibodies

Catalog No.: ATL-HPA031009-25

Protein Description: leucine zipper tumor suppressor family member 3
Gene Name: LZTS3
Alternative Gene Name: KIAA0552, ProSAPiP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037703: 92%, ENSRNOG00000021231: 91%
Entrez Gene ID: 9762
Uniprot ID: O60299
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QEFAMKSVGTRTGGGGSQGSFPGPRGSGSGASRERPGRYPSEDKGLANSLYLNGELRGSDHTDVCGNVVGSSGGSSSSGGSDKAPPQYREPS
• Gene Sequence: QEFAMKSVGTRTGGGGSQGSFPGPRGSGSGASRERPGRYPSEDKGLANSLYLNGELRGSDHTDVCGNVVGSSGGSSSSGGSDKAPPQYREPS
• Gene ID - Mouse: ENSMUSG00000037703
• Gene ID - Rat: ENSRNOG00000021231
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.