Anti LYRM7 pAb (ATL-HPA050053)

Atlas Antibodies

Catalog No.: ATL-HPA050053-25

Protein Description: LYR motif containing 7
Gene Name: LYRM7
Alternative Gene Name: C5orf31, FLJ20796, MZM1L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020268: 85%, ENSRNOG00000045961: 85%
Entrez Gene ID: 90624
Uniprot ID: Q5U5X0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KTLHRTRQQVFKNDARALEAARIKINEEFKNNKSETSSKKIEELMKIGSDVELLLRTSVIQGIHTDHNTLKLVPRKDLLVENVPYCDAPTQKQ
• Gene Sequence: KTLHRTRQQVFKNDARALEAARIKINEEFKNNKSETSSKKIEELMKIGSDVELLLRTSVIQGIHTDHNTLKLVPRKDLLVENVPYCDAPTQKQ
• Gene ID - Mouse: ENSMUSG00000020268
• Gene ID - Rat: ENSRNOG00000045961
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.