Anti LYPD3 pAb (ATL-HPA041529 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA041529-25

Protein Description: LY6/PLAUR domain containing 3
Gene Name: LYPD3
Alternative Gene Name: C4.4A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057454: 47%, ENSRNOG00000019999: 52%
Entrez Gene ID: 27076
Uniprot ID: O95274
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YFSPRIPPLVRLPPPEPTTVASTTSVTTSTSAPVRPTSTTKPMPAPTSQTPRQGVEHEASRDEEPRLTGGAAGHQDRSNSGQYP
• Gene Sequence: YFSPRIPPLVRLPPPEPTTVASTTSVTTSTSAPVRPTSTTKPMPAPTSQTPRQGVEHEASRDEEPRLTGGAAGHQDRSNSGQYP
• Gene ID - Mouse: ENSMUSG00000057454
• Gene ID - Rat: ENSRNOG00000019999
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti LYPD3 pAb (ATL-HPA041529 w/enhanced validation) – 1 Found

Kuonen, François; Li, Nancy Yanzhe; Haensel, Daniel; Patel, Tiffany; Gaddam, Sadhana; Yerly, Laura; Rieger, Kerri; Aasi, Sumaira; Oro, Anthony E. c-FOS drives reversible basal to squamous cell carcinoma transition. Cell Reports. 2021;37(1):109774.