Anti LY75 pAb (ATL-HPA054073)

Atlas Antibodies

Catalog No.: ATL-HPA054073-25

Protein Description: lymphocyte antigen 75
Gene Name: LY75
Alternative Gene Name: CD205, CLEC13B, DEC-205
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026980: 67%, ENSRNOG00000007012: 47%
Entrez Gene ID: 4065
Uniprot ID: O60449
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QRHRLHLAGFSSVRYAQGVNEDEIMLPSFH
• Gene Sequence: QRHRLHLAGFSSVRYAQGVNEDEIMLPSFH
• Gene ID - Mouse: ENSMUSG00000026980
• Gene ID - Rat: ENSRNOG00000007012
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.