Anti LRRC4C pAb (ATL-HPA054800)

Atlas Antibodies

SKU: ATL-HPA054800-25

• 

Protein Description: leucine rich repeat containing 4C
Gene Name: LRRC4C
Alternative Gene Name: KIAA1580, NGL-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050587: 100%, ENSRNOG00000029798: 100%
Entrez Gene ID: 57689
Uniprot ID: Q9HCJ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NVDDEITGDTPMESHLPMPAIEHEHLNHYNSYKSPFNHTTTVNTINSIHSSVHEPLLIRMNSKD
• Gene Sequence: NVDDEITGDTPMESHLPMPAIEHEHLNHYNSYKSPFNHTTTVNTINSIHSSVHEPLLIRMNSKD
• Gene ID - Mouse: ENSMUSG00000050587
• Gene ID - Rat: ENSRNOG00000029798
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.