Anti LRRC1 pAb (ATL-HPA031603 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA031603-100

Protein Description: leucine rich repeat containing 1
Gene Name: LRRC1
Alternative Gene Name: dJ523E19.1, FLJ10775, FLJ11834, LANO
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032352: 87%, ENSRNOG00000005970: 84%
Entrez Gene ID: 55227
Uniprot ID: Q9BTT6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NERAVNRVSAIRFVEDEKDEEDNETRTLLRRATPHPGELKHMKKTVENLRNDMNAAKGLDSNKNEVNHAIDRVTT
• Gene Sequence: NERAVNRVSAIRFVEDEKDEEDNETRTLLRRATPHPGELKHMKKTVENLRNDMNAAKGLDSNKNEVNHAIDRVTT
• Gene ID - Mouse: ENSMUSG00000032352
• Gene ID - Rat: ENSRNOG00000005970
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.