Anti LRCH4 pAb (ATL-HPA037668 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA037668-25

Protein Description: leucine-rich repeats and calponin homology (CH) domain containing 4
Gene Name: LRCH4
Alternative Gene Name: LRN, LRRN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000093445: 73%, ENSRNOG00000001402: 68%
Entrez Gene ID: 4034
Uniprot ID: O75427
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ELSFRISELAREPRGPRERKEDGSADGDPVQIDFIDSHVPGEDEERGTVEEQRPPELSPGAGDRERAPSSRRE
• Gene Sequence: ELSFRISELAREPRGPRERKEDGSADGDPVQIDFIDSHVPGEDEERGTVEEQRPPELSPGAGDRERAPSSRRE
• Gene ID - Mouse: ENSMUSG00000093445
• Gene ID - Rat: ENSRNOG00000001402
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.