Anti LMNTD2 pAb (ATL-HPA058474)

Atlas Antibodies

SKU: ATL-HPA058474-25

• 

Protein Description: lamin tail domain containing 2
Gene Name: LMNTD2
Alternative Gene Name: C11orf35, MGC35138
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025500: 56%, ENSRNOG00000017050: 57%
Entrez Gene ID: 256329
Uniprot ID: Q8IXW0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PETPTCLPDTTPHPAPVVCSADPQLALESLDPRTLRLLWRQRELEIQALRWAIQNGEDARLCHILEEVAGLPPKRSS
• Gene Sequence: PETPTCLPDTTPHPAPVVCSADPQLALESLDPRTLRLLWRQRELEIQALRWAIQNGEDARLCHILEEVAGLPPKRSS
• Gene ID - Mouse: ENSMUSG00000025500
• Gene ID - Rat: ENSRNOG00000017050
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.