Anti LLPH pAb (ATL-HPA048920)

Atlas Antibodies

SKU: ATL-HPA048920-25

• 

Protein Description: LLP homolog, long-term synaptic facilitation (Aplysia)
Gene Name: LLPH
Alternative Gene Name: C12orf31, hLLP, MGC14817
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020224: 72%, ENSRNOG00000004316: 81%
Entrez Gene ID: 84298
Uniprot ID: Q9BRT6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KMQCEVKDEKDDMKMETDIKRNKKTLLDQHGQYPIWMNQRQRKRLKAKREKRKGKSKAKAVKVAKG
• Gene Sequence: KMQCEVKDEKDDMKMETDIKRNKKTLLDQHGQYPIWMNQRQRKRLKAKREKRKGKSKAKAVKVAKG
• Gene ID - Mouse: ENSMUSG00000020224
• Gene ID - Rat: ENSRNOG00000004316
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.