Anti LIPT2 pAb (ATL-HPA040249)

Atlas Antibodies

Catalog No.: ATL-HPA040249-25

Protein Description: lipoyl(octanoyl) transferase 2 (putative)
Gene Name: LIPT2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030725: 91%, ENSRNOG00000016906: 90%
Entrez Gene ID: 387787
Uniprot ID: A6NK58
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CAIGVRCGRHITSHGLALNCSTDLTWFEHIVPCGLVGTGVTSLSKELQRHVTVEEVMPPFLVAFKEIYKCTLISEDS
• Gene Sequence: CAIGVRCGRHITSHGLALNCSTDLTWFEHIVPCGLVGTGVTSLSKELQRHVTVEEVMPPFLVAFKEIYKCTLISEDS
• Gene ID - Mouse: ENSMUSG00000030725
• Gene ID - Rat: ENSRNOG00000016906
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti LIPT2 pAb (ATL-HPA040249) – 1 Found

Bernardinelli, Emanuele; Costa, Roberta; Scantamburlo, Giada; To, Janet; Morabito, Rossana; Nofziger, Charity; Doerrier, Carolina; Krumschnabel, Gerhard; Paulmichl, Markus; Dossena, Silvia. Mis-targeting of the mitochondrial protein LIPT2 leads to apoptotic cell death. Plos One. 12(6):e0179591.