Anti LIN28B pAb (ATL-HPA036630 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA036630-25

Protein Description: lin-28 homolog B (C. elegans)
Gene Name: LIN28B
Alternative Gene Name: CSDD2, FLJ16517
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063804: 85%, ENSRNOG00000025938: 87%
Entrez Gene ID: 389421
Uniprot ID: Q6ZN17
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KKCHYCQSIMHMVANCPHKNVAQPPASSQGRQEAESQPCTSTLPREVGGGHGCTSPPFPQ
• Gene Sequence: KKCHYCQSIMHMVANCPHKNVAQPPASSQGRQEAESQPCTSTLPREVGGGHGCTSPPFPQ
• Gene ID - Mouse: ENSMUSG00000063804
• Gene ID - Rat: ENSRNOG00000025938
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti LIN28B pAb (ATL-HPA036630 w/enhanced validation) – 1 Found

Li, Tong; Jin, Ke; Zhu, Dan-Yan; Li, Lu; Mao, Zheng-Rong; Wu, Bo-Wen; Wang, Yi-Fan; Pan, Zong-Fu; Li, Lan-Juan; Xiang, Chun-Sheng; Su, Kun-Kai; Lou, Yi-Jia. Premalignant alteration assessment in liver-like tissue derived from embryonic stem cells by aristolochic acid I exposure. Oncotarget. 2016;7(48):78872-78882.