Anti LGALS4 pAb (ATL-HPA031185 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA031185-25

Protein Description: lectin, galactoside-binding, soluble, 4
Gene Name: LGALS4
Alternative Gene Name: GAL4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053964: 82%, ENSRNOG00000020338: 78%
Entrez Gene ID: 3960
Uniprot ID: P56470
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQG
• Gene Sequence: YQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQG
• Gene ID - Mouse: ENSMUSG00000053964
• Gene ID - Rat: ENSRNOG00000020338
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.