Anti LEXM pAb (ATL-HPA035890 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA035890-25

Protein Description: lymphocyte expansion molecule
Gene Name: LEXM
Alternative Gene Name: C1orf177, FLJ40201, LEM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054362: 62%, ENSRNOG00000030914: 66%
Entrez Gene ID: 163747
Uniprot ID: Q3ZCV2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SKPLPYGHYSMQKKKPRELMNFKSFVEELNSHHNKKHGVFSKLPRNPKTPTERIYWANLSQCPRTLATSGPSFWLPQEKKCKPVNQPPFLLTSKGSGA
• Gene Sequence: SKPLPYGHYSMQKKKPRELMNFKSFVEELNSHHNKKHGVFSKLPRNPKTPTERIYWANLSQCPRTLATSGPSFWLPQEKKCKPVNQPPFLLTSKGSGA
• Gene ID - Mouse: ENSMUSG00000054362
• Gene ID - Rat: ENSRNOG00000030914
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.