Anti LEPROTL1 pAb (ATL-HPA047911)

Atlas Antibodies

Catalog No.: ATL-HPA047911-25

Protein Description: leptin receptor overlapping transcript-like 1
Gene Name: LEPROTL1
Alternative Gene Name: my047, Vps55
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090290: 29%, ENSRNOG00000017367: 30%
Entrez Gene ID: 23484
Uniprot ID: O95214
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GRLPFFSKMGTAESEGRETLTQQLPLPAAAMRRLLPASRVSTQPVLRLADSAESLLGRPALWALGFLLCPPSQAQ
• Gene Sequence: GRLPFFSKMGTAESEGRETLTQQLPLPAAAMRRLLPASRVSTQPVLRLADSAESLLGRPALWALGFLLCPPSQAQ
• Gene ID - Mouse: ENSMUSG00000090290
• Gene ID - Rat: ENSRNOG00000017367
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.