Anti LEPR pAb (ATL-HPA030899)

Atlas Antibodies

Catalog No.: ATL-HPA030899-25

Protein Description: leptin receptor
Gene Name: LEPR
Alternative Gene Name: CD295, OBR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057722: 79%, ENSRNOG00000023664: 78%
Entrez Gene ID: 3953
Uniprot ID: P48357
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IYFPPKILTSVGSNVSFHCIYKKENKIVPSKEIVWWMNLAEKIPQSQYDVVSDHVSKVTFFNLNETKPRGKFTYDAVYCCNEHECHHRYAEL
• Gene Sequence: IYFPPKILTSVGSNVSFHCIYKKENKIVPSKEIVWWMNLAEKIPQSQYDVVSDHVSKVTFFNLNETKPRGKFTYDAVYCCNEHECHHRYAEL
• Gene ID - Mouse: ENSMUSG00000057722
• Gene ID - Rat: ENSRNOG00000023664
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti LEPR pAb (ATL-HPA030899) – 1 Found

Sudhakar, Manu; Silambanan, Santhi; Chandran, Abhinand S; Prabhakaran, Athira A; Ramakrishnan, Ramya. C-Reactive Protein (CRP) and Leptin Receptor in Obesity: Binding of Monomeric CRP to Leptin Receptor. Frontiers In Immunology. 9( 29910808):1167.