Anti LDLRAD4 pAb (ATL-HPA065246)

Atlas Antibodies

Catalog No.: ATL-HPA065246-25

Protein Description: low density lipoprotein receptor class A domain containing 4
Gene Name: LDLRAD4
Alternative Gene Name: C18orf1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024544: 81%, ENSRNOG00000016879: 81%
Entrez Gene ID: 753
Uniprot ID: O15165
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HYKVSTRSFINRPNQSRRREDGLPQEGCLWPSDSAAPRLGASEIMHAPRSRDRFTAPSFIQRDRFSRFQ
• Gene Sequence: HYKVSTRSFINRPNQSRRREDGLPQEGCLWPSDSAAPRLGASEIMHAPRSRDRFTAPSFIQRDRFSRFQ
• Gene ID - Mouse: ENSMUSG00000024544
• Gene ID - Rat: ENSRNOG00000016879
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.