Anti LCOR pAb (ATL-HPA057621)

Atlas Antibodies

Catalog No.: ATL-HPA057621-25

Protein Description: ligand dependent nuclear receptor corepressor
Gene Name: LCOR
Alternative Gene Name: C10orf12, DKFZP564P1916, FLJ13022, FLJ38026, KIAA1795, MLR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090673: 72%, ENSRNOG00000042679: 70%
Entrez Gene ID: 84458
Uniprot ID: Q8N655
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NSEEGNTCIIPQRNLFKALSEEAWNSGFMGNSSRTADKENTLQCPKTPLRQDLEANEQDARPKQENHLHSLGRNKVGYHLHPSDKGQFD
• Gene Sequence: NSEEGNTCIIPQRNLFKALSEEAWNSGFMGNSSRTADKENTLQCPKTPLRQDLEANEQDARPKQENHLHSLGRNKVGYHLHPSDKGQFD
• Gene ID - Mouse: ENSMUSG00000090673
• Gene ID - Rat: ENSRNOG00000042679
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.