Anti LATS1 pAb (ATL-HPA031804)

Atlas Antibodies

Catalog No.: ATL-HPA031804-25

Protein Description: large tumor suppressor kinase 1
Gene Name: LATS1
Alternative Gene Name: WARTS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040021: 90%, ENSRNOG00000014916: 96%
Entrez Gene ID: 9113
Uniprot ID: O95835
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PSWEPNSQTKRYSGNMEYVISRISPVPPGAWQEGYPPPPLNTSPMNPPNQGQRGISSVPVGRQPIIMQSSSKFNFPSGRP
• Gene Sequence: PSWEPNSQTKRYSGNMEYVISRISPVPPGAWQEGYPPPPLNTSPMNPPNQGQRGISSVPVGRQPIIMQSSSKFNFPSGRP
• Gene ID - Mouse: ENSMUSG00000040021
• Gene ID - Rat: ENSRNOG00000014916
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti LATS1 pAb (ATL-HPA031804) – 1 Found

Britschgi, Adrian; Duss, Stephan; Kim, Sungeun; Couto, Joana Pinto; Brinkhaus, Heike; Koren, Shany; De Silva, Duvini; Mertz, Kirsten D; Kaup, Daniela; Varga, Zsuzsanna; Voshol, Hans; Vissieres, Alexandra; Leroy, Cedric; Roloff, Tim; Stadler, Michael B; Scheel, Christina H; Miraglia, Loren J; Orth, Anthony P; Bonamy, Ghislain M C; Reddy, Venkateshwar A; Bentires-Alj, Mohamed. The Hippo kinases LATS1 and 2 control human breast cell fate via crosstalk with ERα. Nature. 2017;541(7638):541-545.