Anti LAT pAb (ATL-HPA011157 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA011157-25

Protein Description: linker for activation of T cells
Gene Name: LAT
Alternative Gene Name: LAT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030742: 67%, ENSRNOG00000017429: 67%
Entrez Gene ID: 27040
Uniprot ID: O43561
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGSHRTPSSRRDSDG
• Gene Sequence: HCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGSHRTPSSRRDSDG
• Gene ID - Mouse: ENSMUSG00000030742
• Gene ID - Rat: ENSRNOG00000017429
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.