Anti LARS pAb (ATL-HPA036424)

Atlas Antibodies

Catalog No.:
ATL-HPA036424-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: leucyl-tRNA synthetase
Gene Name: LARS
Alternative Gene Name: FLJ10595, FLJ21788, HSPC192, LARS1, LEUS, RNTLS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024493: 96%, ENSRNOG00000018304: 96%
Entrez Gene ID: 51520
Uniprot ID: Q9P2J5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EHWLDYFPPLAIQDLKRMGLKVDWRRSFITTDVNPYYDSFVRWQFLTLRERNKIKFGKRYTIYSPKDGQPCMDHDRQTGEGVGPQEYTLLKLKVL
Gene Sequence EHWLDYFPPLAIQDLKRMGLKVDWRRSFITTDVNPYYDSFVRWQFLTLRERNKIKFGKRYTIYSPKDGQPCMDHDRQTGEGVGPQEYTLLKLKVL
Gene ID - Mouse ENSMUSG00000024493
Gene ID - Rat ENSRNOG00000018304
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LARS pAb (ATL-HPA036424)
Datasheet Anti LARS pAb (ATL-HPA036424) Datasheet (External Link)
Vendor Page Anti LARS pAb (ATL-HPA036424) at Atlas Antibodies

Documents & Links for Anti LARS pAb (ATL-HPA036424)
Datasheet Anti LARS pAb (ATL-HPA036424) Datasheet (External Link)
Vendor Page Anti LARS pAb (ATL-HPA036424)