Anti LAPTM4A pAb (ATL-HPA031402)

Atlas Antibodies

Catalog No.: ATL-HPA031402-25

Protein Description: lysosomal protein transmembrane 4 alpha
Gene Name: LAPTM4A
Alternative Gene Name: HUMORF13, KIAA0108, LAPTM4, MBNT, Mtrp
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020585: 100%, ENSRNOG00000006865: 100%
Entrez Gene ID: 9741
Uniprot ID: Q15012
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EVTHPNSMPAVNIQYEVIGNYYSSERMADN
• Gene Sequence: EVTHPNSMPAVNIQYEVIGNYYSSERMADN
• Gene ID - Mouse: ENSMUSG00000020585
• Gene ID - Rat: ENSRNOG00000006865
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.