Anti LANCL1 pAb (ATL-HPA034994)

Atlas Antibodies

Catalog No.: ATL-HPA034994-25

Protein Description: LanC lantibiotic synthetase component C-like 1 (bacterial)
Gene Name: LANCL1
Alternative Gene Name: GPR69A, p40
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026000: 91%, ENSRNOG00000013557: 91%
Entrez Gene ID: 10314
Uniprot ID: O43813
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAQRAFPNPYADYNKSLAEGYFDAAGRLTPEFSQRLTNKIRELLQQM
• Gene Sequence: MAQRAFPNPYADYNKSLAEGYFDAAGRLTPEFSQRLTNKIRELLQQM
• Gene ID - Mouse: ENSMUSG00000026000
• Gene ID - Rat: ENSRNOG00000013557
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.